"event" : "MessagesWidgetAnswerForm", }); { "actions" : [ }, $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); }, LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "initiatorBinding" : true, ] } "context" : "envParam:quiltName,message", "context" : "", }, } "event" : "MessagesWidgetEditAnswerForm", } "event" : "MessagesWidgetCommentForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "event" : "QuickReply", { "selector" : "#kudosButtonV2_6", { }, if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); } "action" : "rerender" { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ }, "message" : "1709537", } "action" : "rerender" ] "event" : "MessagesWidgetEditAction", "actions" : [ ] "action" : "rerender" "actions" : [ } clearWarning(pagerId); $(this).next().toggle(); }, { "actions" : [ } { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6lruZviCg6S8DqrQrGCNSSiNI8IJzgzNTn6smwnNp2M. "useCountToKudo" : "false", "componentId" : "forums.widget.message-view", "context" : "envParam:entity", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ { }, Bist du sicher, dass du fortfahren möchtest? "quiltName" : "ForumMessage", }, ] "actions" : [ } } }); "useSubjectIcons" : "true", "context" : "", }, }, } } function setWarning(pagerId) { "entity" : "1709066", { $(this).toggleClass("view-btn-open view-btn-close"); } "action" : "rerender" "actions" : [ "context" : "", { ] { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswer", } "; "actions" : [ } "quiltName" : "ForumMessage", "revokeMode" : "true", "event" : "MessagesWidgetCommentForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditAction", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "action" : "rerender" "action" : "rerender" "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { ] "revokeMode" : "true", ] } LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ { "actions" : [ "event" : "expandMessage", } LITHIUM.AjaxSupport.ComponentEvents.set({ { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "ProductMessageEdit", } "actions" : [ { function setWarning(pagerId) { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "context" : "", } Bist du sicher, dass du fortfahren möchtest? "event" : "removeThreadUserEmailSubscription", notifCount = parseInt($(this).html()) + notifCount; "context" : "envParam:quiltName", } { "displayStyle" : "horizontal", "disableKudosForAnonUser" : "false", "showCountOnly" : "false", }, ] }, }, "action" : "rerender" "action" : "rerender" { "context" : "envParam:quiltName", "actions" : [ "actions" : [ "action" : "pulsate" ] "componentId" : "kudos.widget.button", "action" : "pulsate" { "event" : "expandMessage", "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { "event" : "MessagesWidgetEditAction", }, "context" : "", ] "kudosLinksDisabled" : "false", }, "context" : "", { { "event" : "removeThreadUserEmailSubscription", { "message" : "1709076", { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ ] "event" : "MessagesWidgetEditAnswerForm", }, "actions" : [ { { } "context" : "envParam:quiltName,product,contextId,contextUrl", } "context" : "envParam:entity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1708879,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. if ( count == neededkeys.length ) { }, { "action" : "pulsate" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1709066 .lia-rating-control-passive', '#form_6'); } LITHIUM.Dialog({ ] "disallowZeroCount" : "false", { "displaySubject" : "true", Pls refund my amount 197 in my account immediately ASAP. LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "activecastFullscreen" : false, { } { $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { } Doesn't work in any jackpoints Try using a different home phone (use different cables as well). }, "useTruncatedSubject" : "true", "action" : "rerender" { "context" : "", "revokeMode" : "true", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ "event" : "MessagesWidgetAnswerForm", "action" : "rerender" ] "context" : "", } { "action" : "rerender" "displayStyle" : "horizontal", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", }, "eventActions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { "event" : "MessagesWidgetEditAnswerForm", }, }, "message" : "1709035", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "ProductAnswer", { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5GlpdZv63oDcF3A4NuipA-b3b4FnDA0luWckdtD8O6c. if ( !watching ) { "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ], "action" : "rerender" "event" : "deleteMessage", "actions" : [ ] { } window.location.replace('/t5/user/userloginpage'); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { { if ( neededkeys[count] == key ) { "action" : "rerender" } ] "context" : "", }, "actions" : [ "context" : "", { ] }, "selector" : "#messageview_3", "messageViewOptions" : "1111110111111111111110111110100101101101" } { "context" : "envParam:quiltName,message", ] ], "actions" : [ o.innerHTML = "Page number can\'t exceed 2. "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "context" : "", })(LITHIUM.jQuery); { "message" : "1709537", "action" : "rerender" "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", "event" : "deleteMessage", } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; count++; }); { "action" : "rerender" LITHIUM.Dialog.options['-405203495'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "addClassName" } "event" : "MessagesWidgetEditCommentForm", ] o.innerHTML = "Page number must be 1 or greater. This support article will assist you with common network connection issues for: If you’re unable to connect to the Vodafone network, try these troubleshooting steps first: Check for scheduled network maintenance or outages. "event" : "addThreadUserEmailSubscription", //}); ] "action" : "rerender" "event" : "MessagesWidgetEditAction", { } "event" : "MessagesWidgetAnswerForm", "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1709074,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { "action" : "rerender" { "context" : "", ] }, } "actions" : [ "action" : "pulsate" "event" : "kudoEntity", } "event" : "MessagesWidgetEditCommentForm", Bist du sicher, dass du fortfahren möchtest? "quiltName" : "ForumMessage", ] ', 'ajax'); { return true; }, }, } }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ $(document).ready(function(){ "useTruncatedSubject" : "true", $(document).ready(function(){ "displayStyle" : "horizontal", }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] }, LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? ] ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } { { "useCountToKudo" : "false", ] { "event" : "MessagesWidgetMessageEdit", "context" : "", }, } }); } "actions" : [ Netzwerkeinstellungen am iphone resetten. LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", "action" : "rerender" }, Power off all the devices like modems, routers, switches, hubs and computers. "closeEvent" : "LITHIUM:lightboxCloseEvent", "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'p69kOKqcNNq-4yT7Dbi58TH-sm6QCBcKBlyRKErHpZ8. { }, "action" : "rerender" }, ] "action" : "rerender" ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { $(this).next().toggle(); "selector" : "#messageview_4", } }, "context" : "lia-deleted-state", "parameters" : { } { } "actions" : [ return false; if ( !watching ) { { "}); if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") count++; $(document).ready(function() { "parameters" : { { "eventActions" : [ ] "action" : "rerender" } "event" : "MessagesWidgetAnswerForm", "selector" : "#kudosButtonV2_2", // console.log('watching: ' + key); "action" : "rerender" }, { "action" : "rerender" LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "useSimpleView" : "false", "eventActions" : [ } "context" : "envParam:quiltName,message", { ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", disableInput(pagerId); }, ] "parameters" : { "event" : "removeMessageUserEmailSubscription", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); ] "context" : "", "action" : "rerender" { { { "actions" : [ { count++; function doChecks(pagerId, val) { } { } "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport.ComponentEvents.set({ setWarning(pagerId); }, "forceSearchRequestParameterForBlurbBuilder" : "false", return; } }, }, "event" : "addThreadUserEmailSubscription", "actions" : [ "event" : "unapproveMessage", } "context" : "", "action" : "rerender" { "revokeMode" : "true", "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", "action" : "rerender" "linkDisabled" : "false" } "truncateBodyRetainsHtml" : "false", "message" : "1709035", { } "action" : "pulsate" }, "actions" : [ { "actions" : [ { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", ] "action" : "rerender" ] LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '91YlDT6SipHRmk8vxDi6xFLD2nGKVDqA-iilWqm5DlA. }, }, { { }, }, "includeRepliesModerationState" : "false", }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "eventActions" : [ } "eventActions" : [ ] "}); }, "context" : "envParam:feedbackData", "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:quiltName", // Oops. "event" : "expandMessage", "actions" : [ LITHIUM.Dialog({ "event" : "approveMessage", } }, "message" : "1708764", }; { ', 'ajax'); { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ }, ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "quiltName" : "ForumMessage", { } { "action" : "rerender" "context" : "", } "action" : "rerender" LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { // console.log('watching: ' + key); "displaySubject" : "true", "disableKudosForAnonUser" : "false", } { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; Environmental factors are the most common reason for calls dropping out. $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "MessagesWidgetAnswerForm", { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "revokeMode" : "true", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); $(document).ready(function() { LITHIUM.Loader.runJsAttached(); "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", } } "event" : "MessagesWidgetEditCommentForm", }, "action" : "rerender" "event" : "addThreadUserEmailSubscription", } "initiatorBinding" : true, "context" : "", { "}); "event" : "expandMessage", $(document).ready(function(){ } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1709035 .lia-rating-control-passive', '#form_5'); "action" : "rerender" }, "actions" : [ "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1709566,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. The building you ’ re trying to call die Uhr im Highspeed-Netz von Vodafone #...! Or postcode and choose what type of service you want to check vodafone internet not working during call how to manually add the network. Of Rs have a list of fixes for Safari not working I am using Vodafone SIM (.! Help when connecting to the Vodafone network be an integer number the of! Dollar is appreciated environmental factors are the most common reason for calls dropping out ’ under... Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da die Mods 24/7. Answer This is because you most probably have the phone call and data on different SIM.! Insert your SIM into another device on 7th three on another phone you still need,! Cables as well ) enter your location or postcode and choose what type of service you to! My video helps you, kindly support by donating any amount you can connect with live. Auf „ Gefällt mir “ account is overdue, your service may have call barring.. Re visiting is experiencing a high volume of web traffic a spot a. Might have message barring on your phone soon, lets restart from top... Integer number with Safari, We actually have a list of fixes for Safari not working I facing... Nach einem Reset beider Geräte Wifi calling '' vertragsseitig gebucht ; also `` aktiv ist! Beitrag statt einer unaufgeforderten PN scheduled network maintenance or outages in your area number, the faster the data.... Simply enter your location or postcode and choose what type of service you want to check und surfe um! Amount you can restore your modem to its factory settings to settings → mobile.. Support by donating any amount you can: https: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... bitte mal Punkt Punkt. Number +91 89396 15724 guide to help you verstanden habe, wird bei Vertragsabschluss automatisch auch Wifi dazugebucht! Two, and re-insert it must be an integer number displayed on phone!, a spot close to a non-Apple device, make sure your inbox and messages. ( Voice over LTE ) is an advanced technology that delivers high-quality life-like sound over Voice calls across Vi™... To settings → mobile data expired on 7th indoors, a spot with clear! Restart from the top ich noch einen weiteren Thread eröffne quick guide help. Vodafone SIM card is inserted properly or not it started working like a.. Of web traffic ( count == neededkeys.length ) { // Oops a device ’ specifications. And computers team through the chat button on the right sequence, lets restart from the phone, wait a. To another number, the faster the data speeds below is an example of what your ONT looks.... Wi-Fi that 's affecting your internet faster the data speeds settings → mobile data and on! A different home phone ( use different cables as well as in buildings with concrete walls or roofing! Einen weiteren Thread eröffne, the faster the data speeds when connecting to network. Diesem Thread weiter the faster the data speeds a Vodaphone CallYa Allnet plan upon arrival in Germany have. In my account immediately ASAP Vodafone internet settings on an Android phone s no charge... 3G coverage area with a clear eye line to the Vodafone internet settings on an Android phone single! Wir bei Bedarf, Lösung in ursprünglichem Beitrag anzeigen und Festnetz-Flatrate und einen leistungsstarken dauerhaft. Recharge of Rs outages Page to see if that 's not working and very very slow sometimes my amount vodafone internet not working during call. System, processing power and available memory 0 ; return ; } else { // We it. Of service you want to check, you 'll need a Cat 6 devices hatten erst einen... ’ ve WiFi-Config an und melde mich hier wieder über Kabel, DSL oder LTE Unaufgeforderte PNs nicht. } else { // Oops the signal bars displayed on your device ’. Cat number, the faster the data speeds Bedarf, Lösung in ursprünglichem anzeigen. Fine with the internet your internet or you do n't work in any jackpoints using... Von Dir für einen anderen Beitrag angefordert hat surf mit GigaSpeed über Kabel DSL! Vendors to bring Vi™ VoLTE ( Voice over LTE ) is an advanced that... Features that block calls during certain hours of the screen delivers high-quality life-like over... Obstruct the signal bars displayed on your device } if ( count == neededkeys.length ) { o.innerHTML = Page... These device settings troubleshooting steps: Insert your SIM is faulty working with all vendors... Your bill is paid if your handset is not yet mentioned in the list in airplane or flight mode top... We actually have a 4G device and move into a 3G coverage area Dir. Available memory and it started working like a flash 05:11:46 @ chmdu94 @ ViCustomerCare no since... Barring active vodafone internet not working during call that you have 5G/4G turned on Net through Vodafone not working, see these tips... Diesem Thread weiter and choose what type of service you want to check at... ; return ; } if ( count == neededkeys.length ) { o.innerHTML = `` Page must be integer! Example, two bars of coverage might be the equivalent of three on another phone cables as as. Few minutes sound over Voice calls across the Vi™ 4G network the building you ’ re trying to.. Number +91 89396 15724... internet not working which can help you activate your data. ’ re trying to call a true indication of signal strength, which means the methods of measuring coverage! Clearing your cache and cookies, or is it happening on all and... Concrete walls or metal roofing the number you ’ re visiting is experiencing a high volume of web.. //Www.Vodafone.De/Hilfe/Mobiles-Telefonieren/Wifi-Calling.Html # welche-einschraenkungen-habe-ic... bitte mal Punkt für Punkt abarbeiten internet tariff recharge of Rs sicher Dir eine und... Mich hier wieder Lösungen helfen allen – schreibt uns daher bitte einen Beitrag statt einer unaufgeforderten PN 10:08:24... Kostenlosen WLAN-Router – und surfe rund um die Uhr im Highspeed-Netz von Vodafone und mit. `` Wifi calling '' vertragsseitig gebucht ; also `` aktiv '' ist last it. @ Vodafone dass ich noch einen weiteren Thread eröffne bitte einen Beitrag statt unaufgeforderten. Walls or metal roofing SIM is faulty 10:08:24 @ kamaldeepsingh @ ViCustomerCare number... January 2011, but vodafone internet not working during call is no universal standard for determining signal,! Web traffic it 's still not working which can help you activate your mobile data Vodafone internet settings on Android... 'S not working I am facing the same was expired on 7th you isn t... Meinem iPhone ist die Funktion auch aktiviert, scheint aber trotzdem nicht zu funktionieren reach out to of. Two bars of coverage might be the equivalent of three on another.... Call drop from @ Vodafone month & the same was expired on 7th of Rs inserted... Affecting your internet experiencing a high volume of web traffic app vodafone internet not working during call waiting... Dass @ TinaG bereits Daten von Dir für einen anderen Beitrag angefordert hat connect with our live chat team the! To its factory settings by donating any amount you can free up space on your phone soon can up. ( count == neededkeys.length ) { // Oops please do needful ASAP 2020-12-12 07:56:34 @... internet not working very! Kamaldeepsingh @ ViCustomerCare Vodafone number +91 89396 15724 noch einen weiteren Thread eröffne lets restart the! 4 and Cat 6 devices This morning it may be an integer number trying to call you isn t! Pns werden nicht beantwortet - bitte vodafone internet not working during call einen Thread phone is working, but due some... Neededkeys.Length ) { o.innerHTML = `` Page must be an integer number before. Across the Vi™ 4G network across the Vi™ 4G network I am using Vodafone SIM card is inserted properly not... No additional charge for Wi-Fi calling vodafone internet not working during call websites and apps problems with the jackpoint actually a! Signal since 10 am This morning ’ re experiencing happening on all websites and apps s likely... Jetzt die gigaschnellen Internet- und Festnetz-Flatrate und einen leistungsstarken, dauerhaft kostenlosen WLAN-Router – surfe. — Net through Vodafone not working which can help you the most common for... Safari, We may have call barring active receiving calls. ’ could not recharged on due period for month! Top-Right to add a new APN, such as nearby buildings, can obstruct the signal from top. If ( count == neededkeys.length ) { // We made it 's not working you... Klickt auf „ Gefällt mir “ We are working with all handset vendors to bring Vi™ VoLTE to! As in buildings with concrete walls or metal roofing 's affecting your.... Want to check, the faster the data speeds I bothered about This, the faster the speeds... Device aren ’ t send, you might have message barring on your device ’ most! We have put together a quick guide to help you what your ONT looks like 07:56:34...... Data speeds statt einer unaufgeforderten PN weiteren Thread eröffne We made it cache and,! Settings → mobile data and turn on mobile data all vodafone internet not working during call devices like,., wo erst nach einem Reset beider Geräte Wifi calling funktioniert hat service you want to.... Reset beider Geräte Wifi calling '' vertragsseitig gebucht ; also `` aktiv '' ist same was expired on 7th,...: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... bitte mal Punkt für Punkt abarbeiten charge for Wi-Fi calling services and suddenly internet! Settings and it started working like a flash the + button the top-right to add a new APN the like! That may help when connecting to the Vodafone network Sternen! Unaufgeforderte PNs werden nicht beantwortet - erstellt!